PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG004056.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YA
Protein Properties Length: 366aa    MW: 40368 Da    PI: 7.8228
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG004056.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.51.7e-31169225158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +ep+YVNaKQ+++I++RRq+Rak+e ekk   k rkpylheSRh+hA+rR+Rg+gGrF
  CCG004056.1 169 EEPVYVNAKQFNGIMRRRQARAKAELEKKA-VKVRKPYLHESRHQHAMRRARGCGGRF 225
                  69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.6E-36167228IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.536168228IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.0E-28170225IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.6E-23171193IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860173193IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.6E-23202225IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MMPAKSEKED RRLDHSGQSL FQSNVYSQPW WREVGNNPSL GETASKLSSV KNLNGSLLNA  60
VTQSKVNTGL QKGAIVNKDT QADVTSLSDE GTGQHHLNHV PSPTTVTMDG HLEPNSQMEL  120
VGHSIVLTSH PYTDPQYGGI FASYRPQAMV PQFYGMTHAR MPLPLEMEEE PVYVNAKQFN  180
GIMRRRQARA KAELEKKAVK VRKPYLHESR HQHAMRRARG CGGRFLNTKK LDHNAANPTS  240
DKGTGDLDSS GDLQEGKESM VQDMQTHASS NGHGNGNGLS SRYHSLSDDG SFLGQQKETT  300
HGNGVSNGNA KLEASATSNL GEGNFQRVVF LRQFILGFGS FLLGACWWCE WSISYVMDFM  360
LSSDLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-19169232265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299939.20.0hypothetical protein POPTR_0001s27300g
TrEMBLB9GFD80.0B9GFD8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s27300.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89623144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.43e-27nuclear factor Y, subunit A1